Share this post on:

Product Name :
GABRG2-R86
Clone ID/Product Name: GABRG2-R86;
Available to For-Profits: Yes;
Alternate Antibody Name: ;
Gene Symbol: Gabrg2;
Ab Isotype: Rabbit IgG;
Gene Name: ;
Antibody Registry ID: AB_2877081 ;
Uniprot ID: P18508 ;
Entrez Gene ID: 29709 ;
Clonality: Polyclonal;
Immunogen: Synthetic peptide;
Immunogen Sequence: QKSDDDYEDYASNKTWVLTPKVPEGDVTVC ;
Myeloma Strain: ;
Epitope Mapped: Yes;
Antigen Name: Gamma-aminobutyric acid receptor subunit gamma-2;
Epitope Location or Sequence: N-terminus amino acids 1-15;
Alternate Antigen Name: ;
Deposit Date: 6/2/2019;
Antigen Molecular Weight: 54.0 kDa;
Antigen Sequence: ;
Depositor Institution: University of Connecticut;
Antigen Species: Rat;
Depositor Notes: The synthetic peptide immunogen was coupled to a carrier protein by a C-end, which was added if not present in the peptide. IP, IB ;
Host Species: rabbit;
Hybridoma Cells Available : No;
Confirmed Species Reactivity: Rat;
Additional Information: Affinity-purified antibody also validated for IHC and IF.;
Predicted Species Reactivity: ;
Human Protein Atlas: ;
Additional Characterization: ;
Recommended Applications: Immunoprecipitation, Western Blot;

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Iba1 Rabbit mAb In stock
Mepolizumab (anti-IL5) Formula
gamma Catenin Antibody: gamma Catenin Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 82 kDa, targeting to gamma Catenin. It can be used for WB,IHC-F,IHC-P,ICC/IF assays with tag free, in the background of Human.

Share this post on:

Author: nucleoside analogue