Share this post on:

PD 169324

Sequence:  ()

    n-FAM-(AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTISKMDGTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC)
      Molecular Weight: ~ 18.5 kDa
      Validation: Exhibits correct molecular weight
      Solubility: Soluble in 50mM sodium phosphate buffer (pH 8.5) or 10% DMSO in PBS buffer (pH 7.5).
      Fluorescent Dye: mono-5(6)-Carboxyfluorescein (FAM)
      Absorption: 495 nm
      Extinction Coefficient: 77400 M-1 cm-1
      Max Emission: 519 nm
      Storage: Store at -20°C with desiccant.
      Contents: Each vial contains 1 nmol of NET labeled protein.

s11606-011-1788-4

Share this post on:

Author: nucleoside analogue